Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides >>
β-Endorphin, human
Catalogue# Size Purity Price Order
 E55282-0010  10mg  95%  £473.00  
M.W.      3465.07 
Sequence
(one letter code)     
YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE 
Sequence
(three letter code)     
Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu 
Formula      C158H251N39O46
Storage  Longterm storage temperature: -20 ± 5 °C  
 
 
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2024 Designer BioScience Ltd. All rights reserved.