Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides >>
BNP-32, human
Catalogue# Size Purity Price Order
 B56586-00005  0.5mg  95%  £101.20  
M.W.      3464.11 
CAS    114471-18-0 
Sequence
(one letter code)     
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge:Cys10-Cys26
Sequence
(three letter code)     
Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His (Disulfide bridge:Cys10-Cys26
Formula      C143H244N50O42S4 
Storage  Longterm storage temperature: -20 ± 5 °C  
 
 
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2024 Designer BioScience Ltd. All rights reserved.