Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides >>
[Leu116]-Prepro-Neuromedin U (104-136) (human)
Catalogue# Size Purity Price Order
 N100040-0001  1mg  95%  £100.10  
M.W.      3,768.43 
Sequence
(one letter code)     
FLFHYSKTQKLGLSNVVSSVVHPLLQLVPHLHE 
Sequence
(three letter code)     
Phe-Leu-Phe-His-Tyr-Ser-Lys-Thr-Gln-Lys-Leu-Gly-Leu-Ser-Asn-Val-Val-Ser-Ser-Val-Val-His-Pro-Leu-Leu-Gln-Leu-Val-Pro-His-Leu-His-Glu 
Formula      C177H276N46O45 
Storage  Longterm storage temperature: -20 ± 5 °C  
 
 
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2024 Designer BioScience Ltd. All rights reserved.