Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides >>
Growth Hormone Releasing Factor, GRF (1-29), amide,human
Catalogue# Size Purity Price Order
 G61712-0005  5mg  95%  £273.90  
M.W.      3357.97 
CAS    86168-78-7 
Sequence
(one letter code)     
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 
Sequence
(three letter code)     
Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 
Formula      C149H246N44O42
Storage  Longterm storage temperature: -20 ± 5 °C  
 
 
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2024 Designer BioScience Ltd. All rights reserved.