Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides >>
GIP (1-30) porcine amide;Gastric Inhibitory Polypeptide (1-30) amide (porcine); GIP (1-30) amide (porcine); Glucose-Dependent Insulinotropic Polypeptide (1-30) amide (porcine)
Catalogue# Size Purity Price Order
 M88136-0005  5mg  95%  £376.20  
M.W.      3,551.08 
CAS    134846-93-8 
Sequence
(one letter code)     
YAEGTFISDYSIAMDKIRQQDFVNWLLAQK-NH2 
Sequence
(three letter code)     
Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2 
Formula      C162H245N41O47
Storage  Longterm storage temperature: -20 ± 5 °C  
 
 
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2024 Designer BioScience Ltd. All rights reserved.