Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides C >> Chemokines
 
Product Catalogue # Size Price Order
CC Chemokine Receptor 3 Fragment I, amide
MTTSLDTVETFGTTSYYDDVGLLCEKADTR-NH2
 C86745-0001  1mg  £125.40  
 C86745-0005  5mg  £376.20  
 C86745-0010  10mg  £627.00  
CC Chemokine Receptor 3 Fragment II
MTTSLDTVETFGTTSYYDDVGLLC
 C86746-0001  1mg  £97.90  
 C86746-0005  5mg  £293.70  
 C86746-0010  10mg  £489.50  
CC Chemokine Receptor 3 Fragment II, amide
MTTSLDTVETFGTTSYYDDVGLLC-NH2
 C86747-0001  1mg  £101.20  
 C86747-0005  5mg  £303.60  
 C86747-0010  10mg  £506.00  
 
Total 1 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2024 Designer BioScience Ltd. All rights reserved.