Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides C >> Charybdotoxin and Analogs
 
Product Catalogue # Size Price Order
Charybdotoxin
{Glp}FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridges:Cys7-Cys28,Cys13-Cys33, Cys17-Cys35)
 C101407-0001  1mg  £476.30  
 C101407-0005  5mg  £1,428.90  
 C101407-0010  10mg  £2,381.50  
 
Total 1 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2024 Designer BioScience Ltd. All rights reserved.