Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides A >> Apelin Peptides
 
Product Catalogue # Size Price Order
[Ala13]-Apelin-13
QRPRLSHKGPMPA
 A88338-0005  5mg  £118.80  
 A88338-0010  10mg  £198.00  
 A88338-0025  25mg  £396.00  
[Phe17] - Apelin 17
KFRRQRPRLSHKGPMPF
 A88339-0001  1mg  £51.70  
 A88339-0005  5mg  £155.10  
 A88339-0010  10mg  £258.50  
[Pyr1]-Apelin-13
{Pyr}RPRLSHKGPMPF
 A88340-0005  5mg  £122.10  
 A88340-0010  10mg  £203.50  
 A88340-0025  25mg  £407.00  
[Tyr0]-Apelin-13 (human,bovine, mouse, rat)
YQRPRLSHKGPMPF
 A68216-0005  5mg  £128.70  
 A68216-0010  10mg  £214.50  
 A68216-0025  25mg  £429.00  
Apelin-12 (human,bovine, mouse, rat); Apelin Precursor(66-77), Preproapelin(66-77)
RPRLSHKGPMPF
 A71115-0005  5mg  £108.90  
 A71115-0010  10mg  £181.50  
 A71115-0025  25mg  £363.00  
Apelin-13, human, bovine
QRPRLSHKGPMPF
 A55401-0005  5mg  £118.80  
 A55401-0010  10mg  £198.00  
 A55401-0025  25mg  £396.00  
Apelin-15 (63-75)
RRQRPRLSHKGPM
 A88341-0005  5mg  £118.80  
 A88341-0010  10mg  £198.00  
 A88341-0025  25mg  £396.00  
Apelin-15 (63-77)
RRQRPRLSHKGPMPF
 A88342-0001  1mg  £46.20  
 A88342-0005  5mg  £138.60  
 A88342-0010  10mg  £231.00  
Apelin-36, human
LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
 A71114-0001  1mg  £110.00  
 A71114-0005  5mg  £330.00  
 A71114-0010  10mg  £550.00  
 
Total 1 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2017 Designer BioScience Ltd. All rights reserved.