Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides D >> Decorsin
 
Product Catalogue # Size Price Order
Decorsin (Leech)
APRLPQCQGDDQEKCLCNKDECPPGQCRFPRGDADPYCE
 D87186-0001  1mg  £158.40  
 D87186-0005  5mg  £475.20  
 D87186-0010  10mg  £792.00  
 
Total 1 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2024 Designer BioScience Ltd. All rights reserved.