Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides A >> Amyloid Peptides
 
Product Catalogue # Size Price Order
[Arg15,Asp16,25,Pro18,21,23,Val22,Ile24]-Amyloid b-Protein (15-25)
RDLPFFPVPID
 A89303-0005  5mg  £99.00  
 A89303-0010  10mg  £165.00  
 A89303-0025  25mg  £330.00  
[Arg3]-Amyloid β-Protein (1-40)
DARFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
 A89292-0001  1mg  £202.40  
 A89292-0001  10mg  £1,012.00  
 A89292-0005  5mg  £607.20  
[Asn670,Leu671]-Amyloid b/A4 Protein Precursor770 (667-675)
SEVNLDAEF
 A89313-0005  5mg  £108.90  
 A89313-0010  10mg  £181.50  
 A89313-0025  25mg  £363.00  
[Asn670,Leu671]-Amyloid b/A4 Protein Precursor770 (667-676)
SEVNLDAEFR
 A89315-0005  5mg  £92.40  
 A89315-0010  10mg  £154.00  
 A89315-0025  25mg  £308.00  
[D-Asp1]-Amyloid- β-Protein (1-42)
{D-Asp}AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
 A89294-0001  1mg  £218.90  
 A89294-0005  5mg  £656.70  
 A89294-0010  10mg  £1,094.50  
[Gln11]-β-Amyloid (1-16)
DAEFRHDSGYQVHHQK
 A87933-0005  5mg  £145.20  
 A87933-0010  10mg  £242.00  
 A87933-0025  25mg  £484.00  
[Gln11]-β-Amyloid (1-28)
DAEFRHDSGYQVHHQKLVFFAEDVGSNK
 A87934-0001  1mg  £113.30  
 A87934-0005  5mg  £339.90  
 A87934-0010  10mg  £566.50  
[Gln11]-β-Amyloid (1-40)
DAEFRHDSGYQVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
 A87935-0001  1mg  £202.40  
 A87935-0005  5mg  £607.20  
 A87935-0010  10mg  £1,012.00  
[Gln22]-25359-Amyloid (6-40)
HDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV
 A87936-0001  1mg  £177.10  
 A87936-0005  5mg  £531.30  
 A87936-0010  10mg  £885.50  
[Gln22]-β-Amyloid (1-40)
DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV
 A74039-0001  1mg  £202.40  
 A74039-0005  5mg  £607.20  
 A74039-0010  10mg  £1,012.00  
 
Total 11 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2017 Designer BioScience Ltd. All rights reserved.