Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides A >> Amylins and Fragments
 
Product Catalogue # Size Price Order
Ac-Amylin (8-37), human
Ac-ATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2
 A89378-0001  1mg  £129.80  
 A89378-0005  5mg  £389.40  
 A89378-0010  10mg  £649.00  
Ac-Amylin (8-37), rat
Ac-ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2
 A87931-0001  1mg  £97.90  
 A87931-0005  5mg  £293.70  
 A87931-0010  10mg  £489.50  
Amylin (1-13) (human)
KCNTATCATQRLA (Disulfide bridge:Cys2-Cys7)
 A89376-0001  1mg  £52.80  
 A89376-0005  5mg  £158.40  
 A89376-0010  10mg  £264.00  
Amylin (20-29) (human)
SNNFGAILSS
 A89379-0005  5mg  £92.40  
 A89379-0010  10mg  £154.00  
 A89379-0025  25mg  £308.00  
Amylin (8-37), human
ATQRLANFLVHSSNNFGAILSSTNVGSNTY
 A55237-0001  1mg  £125.40  
 A55237-0005  5mg  £376.20  
 A55237-0010  10mg  £627.00  
Amylin (8-37),rat
ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2
 A55284-0001  1mg  £94.60  
 A55284-0005  5mg  £283.80  
 A55284-0010  10mg  £473.00  
Amylin (IAPP)(Feline)
KCNTATCATQRLANFLIRSSNNLGAILSPTNVGSNTY-NH2 (Disulfide bridge:Cys2-Cys7)
 A55201-00005  0.5mg  £127.60  
 A55201-0001  1mg  £216.70  
 A55201-00025  2.5mg  £422.40  
Amylin, rat
KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Disulfide bridge:Cys2-Cys7)
 A55204-00005  0.5mg  £101.20  
 A55204-0001  1mg  £171.60  
 A55204-00025  2.5mg  £303.60  
Amylin,human
KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 (Disulfide bridge:Cys2-Cys7)
 A52219-0001  1mg  £154.00  
 A52219-0005  5mg  £462.00  
 A52219-0010  10mg  £770.00  
 
Total 1 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2017 Designer BioScience Ltd. All rights reserved.