Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides A >> Adrenomedullins
 
Product Catalogue # Size Price Order
Adrenomedullin (1- 52),porcine
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDGVAPRSKISPQGY-NH2 (Disulfide bridge :Cys16-Cys21)
 A100825-0001  1mg  £232.10  
 A100825-0005  5mg  £696.30  
 A100825-0010  10mg  £1,160.50  
Adrenomedullin (1-12), human
YRQSMNNFQGLR
 A100824-0005  5mg  £108.90  
 A100824-0010  10mg  £181.50  
 A100824-0025  25mg  £363.00  
Adrenomedullin (11-50) (rat)
STGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: Cys4-Cys9 )
 A100047-0001  1mg  £232.10  
 A100047-0005  5mg  £696.30  
 A100047-0010  10mg  £1,160.50  
Adrenomedullin (13-52),human
SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge:Cys16-Cys21)
 A55425-0001  1mg  £232.10  
 A55425-0005  5mg  £696.30  
 A55425-0010  10mg  £1,160.50  
Adrenomedullin (1-50), rat
YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge:Cys14-Cys19)
 A100046-0001  1mg  £232.10  
 A100046-0005  5mg  £696.30  
 A100046-0010  10mg  £1,160.50  
Adrenomedullin (1-52), human
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: Cys16-Cys21)
 A55426-0001  1mg  £232.10  
 A55426-0005  5mg  £696.30  
 A55426-0010  10mg  £1,160.50  
Adrenomedullin (16-31) (human, pig)
CRFGTCTVQKLAHQIY-NH2 (Disulfide bridge:Cys1-Cys6)
 A100048-0001  1mg  £138.60  
 A100048-0005  5mg  £425.70  
 A100048-0010  10mg  £693.00  
Adrenomedullin (22-52),human
TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
 A55286-0001  1mg  £115.50  
 A55286-0005  5mg  £346.50  
 A55286-0010  10mg  £577.50  
Adrenomedullin (26-52) (human)
LAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
 A100049-0001  1mg  £84.70  
 A100049-0005  5mg  £254.10  
 A100049-0010  10mg  £423.50  
Prepro-adrenomedullin (153-185), human
SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL
 A100826-0001  1mg  £138.60  
 A100826-0005  5mg  £402.60  
 A100826-0010  10mg  £671.00  
 
Total 2 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2017 Designer BioScience Ltd. All rights reserved.