Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides V >> VIP, Prepro VIP, Analogs and Fragments
 
Product Catalogue # Size Price Order
Prepro VIP (111-122) (human); PHM/VIP (Spacer Peptide)
VSSNISEDPVPV
 V89586-0005  5mg  £108.90  
 V89586-0010  10mg  £181.50  
 V89586-0025  25mg  £363.00  
Prepro VIP (156-170) (human)
SSEGESPDFPEELEK
 V89587-0001  1mg  £60.50  
 V89587-0005  5mg  £181.50  
 V89587-0010  10mg  £302.50  
Prepro VIP (81-122) (human)
HADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPV
 V89585-0001  1mg  £170.50  
 V89585-0005  5mg  £511.50  
 V89585-0010  10mg  £852.50  
VIP Receptor-Binding Inhibitor, L-8-K
LMYPTYLK
 W87444-0005  5mg  £72.60  
 W87444-0010  10mg  £165.00  
 W87444-0025  25mg  £330.00  
 
Total 1 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2024 Designer BioScience Ltd. All rights reserved.