Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides V >> Vasoactive Intestinal Contractor Peptides (VIC)
 
Product Catalogue # Size Price Order
Vasoactive Intestinal Constractor [VIC]; Endophilin Beta, Mouse
CSCNSWLDKECVYFCHLDIIW(Disulfide bridges: Cys1-Cys15, Cys3-Cys11)
 V101771-0001  1mg  £63.80  
 V101771-0005  5mg  £191.40  
 V101771-0010  10mg  £319.00  
Vasoactive Intestinal Contractor [VIC]
CSCNSWLDKECVYFCHLDIIW(Disulfide bridge: Cys1-Cys11, Cys3-Cys15 )
 V88432-0001  1mg  £172.70  
 V88432-0005  5mg  £518.10  
 V88432-0010  10mg  £863.50  
Vasoactive Intestinal peptide
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
 V51550-0001  1mg  £88.00  
 V51550-0005  5mg  £264.00  
 V51550-0010  10mg  £440.00  
 
Total 1 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2024 Designer BioScience Ltd. All rights reserved.