Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides P >> Pancreastatin/Chromogranin A Sequences
 
Product Catalogue # Size Price Order
Pancreastatin, porcine
GWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRG-NH2
 P52292-00005  0.5mg  £264.00  
 P52292-0001  1mg  £448.80  
 P52292-00025  2.5mg  £792.00  
Chromogranin A (324-337), human
WSKMDQLAKELTAE
 P88504-0005  5mg  £128.70  
 P88504-0010  10mg  £214.50  
 P88504-0025  25mg  £429.00  
 
Total 1 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2024 Designer BioScience Ltd. All rights reserved.