Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides M >> Melanin-Concentrating Hormones (MCH) and Related Peptides
 
Product Catalogue # Size Price Order
[D-Arg6,Asn10]-MCH (6-16) amide (human, mouse, rat)
Ac-{D-Arg}CMLNRVYRPC-NH2 (Disulfide bridge Cys2-Cys11)
 M89910-0005  5mg  £158.40  
 M89910-0010  10mg  £264.00  
 M89910-0025  25mg  £528.00  
[Phe13,Tyr19]-MCH (human,mouse, rat)
DFDMLRCMLGRVFRPCWQY (Disulfide bridge: Cys7-Cys16)
 M89911-0001  1mg  £71.50  
 M89911-0005  5mg  £214.50  
 M89911-0010  10mg  £357.50  
Biotinyl-MCH (salmon)
Biotin-DTMRCMVGRVYRPCWEV (Disulfide bridge:Cys5-Cys14)
 M89908-0001  1mg  £63.80  
 M89908-0005  5mg  £191.40  
 M89908-0010  10mg  £319.00  
MCH-Gene-Overprinted-Polypeptide-14 (rat)
TIHCKWREKPLMLM
 M89912-0005  5mg  £128.70  
 M89912-0010  10mg  £214.50  
 M89912-0025  25mg  £429.00  
MCH-Gene-Overprinted-Polypeptide-27 (rat)
SDTCWSTTSFQKKTIHCKWREKPLMLM (Disulfide bridge: Cys4-Cys17)
 M89913-0001  1mg  £95.70  
 M89913-0005  5mg  £188.10  
 M89913-0010  10mg  £478.50  
Melanin Concentrating Hormone, human, mouse, rat MCH, human, mouse, rat
DFDMLRCMLGRVYRPCWQV (Disulfide bridge Cys7-Cys16)
 M52270-00005  0.5mg  £77.00  
 M52270-0001  1mg  £130.90  
 M52270-0002  2mg  £231.00  
Melanin Concentrating Hormone, salmon MCH,salmon
DTMRCMVGRVYRPCWEV (Disulfide bridge Cys5-Cys14)
 M52271-00005  0.5mg  £77.00  
 M52271-0001  1mg  £130.90  
 M52271-0002  2mg  £231.00  
Neuropeptide EI-Gly-Arg-Arg-MCH (human, mouse, rat)
EIGDEENSAKFPIGRRDFDMLRCMLGRVYRPCWQV (Disulfide bridge:Cys23-Cys32)
 M89914-0001  1mg  £171.60  
 M89914-0005  5mg  £514.80  
 M89914-0010  10mg  £858.00  
 
Total 1 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2024 Designer BioScience Ltd. All rights reserved.