Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides K >> Kisspeptin Peptides
 
Product Catalogue # Size Price Order
Kisspeptin-13 (4-13) (human)
YNWNSFGLRF-NH2
 K54842-0005  5mg  £99.00  
 K54842-0010  10mg  £165.00  
 K54842-0025  25mg  £330.00  
Kisspeptin-13 (human)
LPNYNWNSFGLRF-NH2
 K89211-0005  5mg  £128.70  
 K89211-0010  10mg  £214.50  
 K89211-0025  25mg  £429.00  
Kisspeptin-54 (27-54) (human)
IPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2
 K89212-0001  1mg  £88.00  
 K89212-0005  5mg  £264.00  
 K89212-0010  10mg  £440.00  
 
Total 1 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2024 Designer BioScience Ltd. All rights reserved.