Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides G >> Growth Hormones
 
Product Catalogue # Size Price Order
Human Growth Hormone(1-43); hGH(1-43)
FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYS
 G89090-0001  1mg  £178.20  
 G89090-0005  5mg  £534.60  
 G89090-0010  10mg  £891.00  
 
Total 1 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2024 Designer BioScience Ltd. All rights reserved.