Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides G >> Growth Hormone-Releasing Factors (GRF)
 
Product Catalogue # Size Price Order
Growth Hormone Releasing Factor, GRF (1-29), amide,human
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
 G61712-0001  1mg  £91.30  
 G61712-0005  5mg  £273.90  
 G61712-0010  10mg  £456.50  
Growth Hormone Releasing Factor, GRF (1-40), amide,human
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGA-NH2
 G88147-0001  1mg  £166.10  
 G88147-0005  5mg  £498.30  
 G88147-0010  10mg  £830.50  
Growth Hormone Releasing Factor, GRF (1-44), amide,bovine
YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2
 G55420-0001  1mg  £182.60  
 G55420-0005  5mg  £547.80  
 G55420-0010  10mg  £913.00  
Growth Hormone Releasing Factor, GRF, (1-40), human
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGA
 G88148-0001  1mg  £162.80  
 G88148-0005  5mg  £488.40  
 G88148-0010  10mg  £814.00  
 
Total 1 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2024 Designer BioScience Ltd. All rights reserved.