Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides G >> Gastrin Releasing Peptide (GRP) and Sequences
 
Product Catalogue # Size Price Order
Biotin-Gastrin Releasing Peptide, human
Biotin-VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
 G88141-0001  1mg  £102.30  
 G88141-0005  5mg  £306.90  
 G88141-0010  10mg  £511.50  
Gastrin Releasing Peptide(1-16), human
VPLPAGGGTVLTKMYP
 G101813-0001  1mg  £48.40  
 G101813-0005  5mg  £145.20  
 G101813-0010  10mg  £242.00  
Gastrin Releasing Peptide,human
VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
 G52254-0001  1mg  £84.70  
 G52254-0005  5mg  £254.10  
 G52254-0010  10mg  £423.50  
Gastrin Releasing Peptide,procine
APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2
 G52255-0001  1mg  £84.70  
 G52255-0005  5mg  £254.10  
 G52255-0010  10mg  £423.50  
Gastrin Releasing Peptide-Lys(Biotin), human
VPLPAGGGTVLTKMYPRGNHWAVGHLM{Lys(Biotin)}
 G101041-0001  1mg  £128.70  
 G101041-0005  5mg  £386.10  
 G101041-0010  10mg  £643.50  
 
Total 1 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2024 Designer BioScience Ltd. All rights reserved.