Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides N >>
 
Product Catalogue # Size Price Order
Pancreatic Polypeptide (1-17)-(Ala31,Aib32)-Neuropeptide Y (18-36) (human)
APLEPVYPGDNATPEQMARYYSALRHYINLA{Aib}RQRY-NH2
 N100074-0001  1mg  £149.60  
 N100074-0005  5mg  £448.80  
 N100074-0010  10mg  £748.00  
 
Total 4 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2024 Designer BioScience Ltd. All rights reserved.