Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides A >>
 
Product Catalogue # Size Price Order
Atrial Natriuretic Peptide (1-28),rat
SLRRSSCFGGRIDRIGAQSGLGCNSFRY (Disulfide bridge:Cys7-Cys23)
 A55278-00005  0.5mg  £105.60  
 A55278-0001  1mg  £179.30  
 A55278-00025  2.5mg  £316.80  
Atrial Natriuretic Peptide (4-24),frog
CFGSRIDRIGAQSGMGCGRRF (Disulfide bridge: Cys1-Cys17)
 A101107-00005  0.5mg  £72.60  
 A101107-0001  1mg  £135.30  
 A101107-00025  2.5mg  £316.80  
Atrial Natriuretic Peptide Substrate, [pS6] ANF 1-28
SLRRS{pSer}CFGGRIDRIGAQSGLGCNSFRY (Disulfide bridge : Cys7-Cys23)
 A101107-00005  0.5mg  £105.60  
 A101107-0001  1mg  £179.30  
 A101107-00025  2.5mg  £316.80  
Biotin-Atrial Natriuretic Peptide (1-28), human,porcine
Biotin-SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge Cys7-Cys23)
 A101108-0001  1mg  £135.30  
 A101108-0005  5mg  £405.90  
 A101108-0010  10mg  £676.50  
Prepro-Atrial Natriuretic Factor (104-116), human
SSDRSALLKSKLR
 A101755-0005  5mg  £118.80  
 A101755-0010  10mg  £198.00  
 A101755-0025  25mg  £396.00  
Prepro-Atrial Natriuretic Factor (104-123) (human)
SSDRSALLKSKLRALLTAPR
 A100533-0001  1mg  £60.50  
 A100533-0005  5mg  £181.50  
 A100533-0010  10mg  £302.50  
Prepro-Atrial Natriuretic Factor (26-55) (human); Prepro-hANF (26-55) Cardiodilatin-Related Peptide (human)
NPMYNAVSNADLMDFKNLLDHLEEKMPLED
 A100531-0001  1mg  £122.10  
 A100531-0005  5mg  £366.30  
 A100531-0010  10mg  £610.50  
Prepro-Atrial Natriuretic Factor (56-92) (human)
EVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQR
 A100532-0001  1mg  £149.60  
 A100532-0005  5mg  £448.80  
 A100532-0010  10mg  £748.00  
 
Total 2 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2024 Designer BioScience Ltd. All rights reserved.